Description
Sermorelin 10 mg — Opti-Gen Peptides
For laboratory research use only.
Not for human use. Not for veterinary use.
This listing is not an MHRA-licensed medicine.
Research-grade synthetic peptide supplied as a 10 mg sealed vial for lawful laboratory research in the UK. Not a food, supplement or medical device on this page. Not for diagnostic or therapeutic use on this listing. Must not be administered to people or animals.
Licensed sermorelin presentations (where they exist or existed) are separate regulated products. This vial is not those products.
Identification
| Product name | Sermorelin |
| Also listed as | GHRH(1–29)-NH₂ |
| Supplier | Opti-Gen Peptides |
| Contents | 10 mg per vial |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
| CAS | 86168-78-7 |
| Approx. mass | ~3358 Da |
| Class | Synthetic GHRH(1–29) amide |
| Intended use | Laboratory / in-vitro research only |
Not tesamorelin, CJC-1295 or unmodified GHRH(1–44).
Quality / storage
Only the lot COA applies. Store as a laboratory peptide under institutional SOP. No reconstitution or injection instructions on this page.
Published research context (not product claims)
Sermorelin is the amidated 1–29 fragment of GHRH. It was characterised in Guillemin / Rivier GHRH chemistry and used as a GHRH-receptor research ligand.
In some markets it was supplied as a regulated diagnostic (Geref). That history applies only to authorised presentations, not this research vial.
GHRH analogues may be WADA-restricted. There is no authorisation to market this listing as a UK growth-hormone or anti-ageing product.
UK notice
18+. Buyer confirms lawful laboratory research use only and will not use or resell for unauthorised human or animal use.







Reviews
There are no reviews yet.