Description
VIP 10mg — Opti-Gen Peptides
For laboratory research use only.
Not for human use. Not for veterinary use.
Not licensed by the MHRA. Not a medicinal product.
Research-grade synthetic 28-amino-acid peptide supplied as a 10 mg sealed vial for lawful laboratory research in the UK. Not a food, supplement or medical device on this page. Not for diagnostic or therapeutic use. Must not be administered to people or animals.
Licensed or investigational vasoactive intestinal peptide / aviptadil presentations are separate products. This vial is not those products.
Identification
| Product name | VIP |
| Also listed as | Vasoactive intestinal peptide; vasoactive intestinal polypeptide |
| Supplier | Opti-Gen Peptides |
| Contents | 10 mg per vial |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| CAS | 40077-57-4 |
| Length / mass | 28 aa; ~3326 Da |
| Class | Synthetic PACAP/VIP-family peptide |
| Intended use | Laboratory / in-vitro research only |
Quality / storage
Only the lot COA applies. Store as a laboratory peptide under institutional SOP. No inhalation, infusion or injection instructions on this page.
Published research context (not product claims)
VIP is a 28-residue amidated peptide of the secretin / PACAP family. Receptor papers use it as a VPAC1 / VPAC2 research ligand in cell-signalling assays.
Clinical-development work on aviptadil and other VIP formulations concerns regulated or investigational drug products. Those programmes are not authorisation to sell this vial as a lung, COVID or vascular medicine.
The historical name vasoactive intestinal peptide describes the original isolation source. It is not a product claim that this listing treats blood vessels, gut or erectile function.
There is no UK marketing authorisation for this research vial.
UK notice
18+. Buyer confirms lawful laboratory research use only and will not use or resell for unauthorised human or animal use.







Reviews
There are no reviews yet.